PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041362
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HD-ZIP
Protein Properties Length: 545aa    MW: 60573 Da    PI: 8.4444
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041362genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.92.7e-21121176156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Lus10041362 121 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 176
                  688999***********************************************999 PP

2START90.14.6e-2925335971165
                  CT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEE CS
        START  71 qWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliep 156
                  +W e+++    + +t++vis+g      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++++   + +  +++lpSg+++++
  Lus10041362 253 RWAEMFPcmiaRTSTTDVISNGmggtrnGSLQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSVDAIREVSGgPPIFLSCRRLPSGCVVQD 350
                  68888888888*******************************************************************988999************** PP

                  ECTCEEEEE CS
        START 157 ksnghskvt 165
                  ++ng+skvt
  Lus10041362 351 MPNGYSKVT 359
                  ********8 PP

3START69.31.1e-22375436145206
                  -EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 145 aellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                  +++  Sg+++++++ng+skvtwveh +++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  Lus10041362 375 SRRVASGCVVQDMPNGYSKVTWVEHGEYEESQIHQLYRPLIQSGMGFGAQRWVATLQRQCEC 436
                  57889*******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.19E-21106178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-22108178IPR009057Homeodomain-like
PROSITE profilePS5007117.216118178IPR001356Homeobox domain
SMARTSM003899.9E-18119182IPR001356Homeobox domain
PfamPF000468.1E-19121176IPR001356Homeobox domain
CDDcd000865.61E-18121178No hitNo description
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
SMARTSM002346.2E-19188436IPR002913START domain
PROSITE profilePS5084825.927246439IPR002913START domain
SuperFamilySSF559613.3E-12250359No hitNo description
CDDcd088751.37E-77252435No hitNo description
PfamPF018525.1E-23253359IPR002913START domain
PfamPF018522.9E-18375436IPR002913START domain
SuperFamilySSF559615.91E-8376436No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MSFGFLENGS PGGGRFIADY TTATTMSTSG GGMVQPRLLS PNSFSKSMFS SPGLSLALVR  60
PQQPNMDGGR QGEFGRMTEN YETSVGRIRS REEEHDSRSG SDNLDGASGD EQDAADKPPR  120
KKRYHRHTPQ QIQELEALFK ECPHPDEKQR LELSKRLCLE TRQVKFWFQN RRTQMKTQLE  180
RHENTLLRQE NDKLRAENMS IRDAMRNPMC SNCGGPAIIG DISLEEQHLR IENARLKDEL  240
DRVCGRFEPH WNRWAEMFPC MIARTSTTDV ISNGMGGTRN GSLQLMHAEL QVLSPLVPVR  300
EVNFLRFCKQ HAEGVWAVVD VSVDAIREVS GGPPIFLSCR RLPSGCVVQD MPNGYSKVTA  360
KKKSLLLLSC ILVPSRRVAS GCVVQDMPNG YSKVTWVEHG EYEESQIHQL YRPLIQSGMG  420
FGAQRWVATL QRQCECLAIL MSSTVPARDH TAAITASGRR SMLKLAQRMT DNFCAGVCAS  480
TVHKWNKLNG GNVEEDVRVM TRKSVDDPGE PPGIVLSAAT SVWLPVSPSP RRLGWATGCT  540
PAPV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511801.11e-151PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_015867375.11e-153PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X2
SwissprotQ0WV121e-122ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A078G2K70.0A0A078G2K7_BRANA; BnaC04g04470D protein
STRINGPOPTR_0014s07130.11e-147(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-123HD-ZIP family protein